Transcript | Ll_transcript_405900 |
---|---|
CDS coordinates | 1539-1889 (+) |
Peptide sequence | MQGNEVSLQKVLNMVERNNHEYVAVLFYASWCPFSQIFRPVFSILSFLNPSILHLAIEESSARPSTLSKYGVRGFPILFILNSTMCARYHGSRTLDSLVSFYSDVTGKAHSFTHYT* |
ORF Type | complete |
Blastp | 5'-adenylylsulfate reductase-like 4 from Arabidopsis with 54.81% of identity |
---|---|
Blastx | 5'-adenylylsulfate reductase-like 4 from Arabidopsis with 65.09% of identity |
Eggnog | thioredoxin domain containing 15(ENOG4111M6Z) |
Kegg | Link to kegg annotations (AT1G34780) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019417607.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer