Protein coding transcript 74162

• Transcript: Ll_transcript_404985
• CDS coordinates: 2-1075 (+)
• Peptide sequence: ANHFHDCTTTEEKGRNMEIKAGLSALVTGAASGIGKSLVLALAEKGIFITLVDFSEEKGRELAALVQEINTKFHPNLDFPSALFFKCDVTNSRDLAAAFEKHYLTYGGLDICINSAGISNPIEFHKDQTDGTRSWKHTVNVNFTAVIECTRLAIKTMEAAKRPGAIINLGSASGLYPMYFDPIYSASKGGVVMFTRALRLYKRQGIRINVLCPEFIETEMGKKVDPRFVSWMGGFVPMELLIKGAFELITDESKAGHCLWITNRRGLEYWPTPSEEAKYLTSSVSRLRQRSEFKAPSVKLPDSFEKMCVFELYFPCNNKFMPFGDVYFLFPYSFIEERVQCNYIFKLTIYAHFYLLKD
• ORF Type: internal

Annotations of Ll_transcript_404985

• Blastp: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] from Bos with 31.75% of identity
• Blastx: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] from Bos with 31.75% of identity
• Eggnog: Dehydrogenase reductase(COG1028)
• Kegg: Link to kegg annotations (512259)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422170.1)
• Pfam: short chain dehydrogenase (PF00106.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;