Protein coding transcript 74170

• Transcript: Ll_transcript_406134
• CDS coordinates: 370-963 (+)
• Peptide sequence: MHTLIRDRDISKHDFVFYSDRLIRLVVEHGLGHLPFTEKQVVTPTGSVYTGVDFCKKLCGVSIIRSGESMENALHACCKGIKIGKILIHRDGDYGKQLIYENLPKDISELHVLLLDPVLATGNSANQAIELLIQKGVPESHIIFLNLISAPEGIHCVFKRFPSLKIVTSEIDIAVNKEYRVVPGLGEFGDRYFGTDD*
• ORF Type: complete

Annotations of Ll_transcript_406134

• Blastp: Uridine kinase-like protein 1, chloroplastic from Arabidopsis with 90.86% of identity
• Blastx: Uridine kinase-like protein 1, chloroplastic from Arabidopsis with 90.37% of identity
• Eggnog: Catalyzes the conversion of uracil and 5-phospho-alpha- D-ribose 1-diphosphate (PRPP) to UMP and diphosphate (By similarity)(COG0035)
• Kegg: Link to kegg annotations (AT5G40870)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003547653.1)
• Pfam: Uracil phosphoribosyltransferase (PF14681.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;