Protein coding transcript 7418

• Transcript: Ll_transcript_395677
• CDS coordinates: 358-906 (+)
• Peptide sequence: MIHLFLKMKDHQGAYKMLDYLEEINLKPTASMYNVIMAECFREKNIRDGVRVLEHMQNADVKADSQTFSYLISNSETEDDIVKYYEELKQSGVKATKQIFIALINAYAACGQLEKAKQVVLDPLIPVKSLNQIKSILVSVLASHGQLSEALLIYEEIKQAGHTLEPRYYEYHCEILIILVIL*
• ORF Type: complete

Annotations of Ll_transcript_395677

• Blastp: Pentatricopeptide repeat-containing protein At4g04790, mitochondrial from Arabidopsis with 50.9% of identity
• Blastx: Pentatricopeptide repeat-containing protein At4g21880, mitochondrial from Arabidopsis with 48.68% of identity
• Eggnog: Pentatricopeptide repeat-containing protein(ENOG410Z7Z7)
• Kegg: Link to kegg annotations (AT4G04790)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458206.1)
• Pfam: Pentatricopeptide repeat domain (PF13812.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;