Protein coding transcript 74290

• Transcript: Ll_transcript_407425
• CDS coordinates: 2-508 (+)
• Peptide sequence: VYKATLAEQAERYEEMVEFMEKVSAAADNEELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEESRGNDDHVSIIRDYRSKIESELSNICDGILKLLDSRLIPSASSGDSKVFYLKMKGDYHRYLAEFKTGAERKDAAESTLAAYKSAQDIANTELPPTHPIRLGLA
• ORF Type: internal

Annotations of Ll_transcript_407425

• Blastp: 14-3-3-like protein from Pisum with 92.9% of identity
• Blastx: 14-3-3-like protein from Pisum with 92.9% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438524.1)
• Pfam: 14-3-3 protein (PF00244.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;