Protein coding transcript 74292

• Transcript: Ll_transcript_407428
• CDS coordinates: 53-514 (+)
• Peptide sequence: MVEIPEKVSAAADNEELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEESRGNDDHVSIIRDYRSKIESELSNICDGILKLLDSRLIPSAASGDSKVFYLKMKGDYHRYLAEFKTGAERKDAAESTLAAYKSAQDIANTELPPTHPIRLGLA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_407428

• Blastp: 14-3-3-like protein from Pisum with 91.56% of identity
• Blastx: 14-3-3-like protein from Pisum with 90.53% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415516.1)
• Pfam: 14-3-3 protein (PF00244.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;