Protein coding transcript 743

• Transcript: Ll_transcript_332596
• CDS coordinates: 3-611 (+)
• Peptide sequence: VLFFQEAIKGVIDEFKTPESENPLLEEFQFQWRYANGLLAIIFSVGLIGASLKSRRARTWRYGTGWLRGFIADYGCPLMVVFWTALSYGKPGKVPHGVPRRLFCPLPWDPASLYHWTVIKDMMKVPVIYILAAILPALMIAGLYFFDHSVASKMAQQKEFNLQKPSAYHYDMLLLGIMTLICGVLGLPPSNGVLPQSPMHTKS
• ORF Type: internal

Annotations of Ll_transcript_332596

• Blastp: Boron transporter 4 from Arabidopsis with 72.91% of identity
• Blastx: Boron transporter 4 from Arabidopsis with 72.91% of identity
• Eggnog: solute carrier family 4(ENOG410XPHD)
• Kegg: Link to kegg annotations (AT1G15460)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414843.1)
• Pfam: HCO3- transporter family (PF00955.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;