Protein coding transcript 74305

• Transcript: Ll_transcript_405124
• CDS coordinates: 94-465 (+)
• Peptide sequence: MGIIEEAHNVRVIGKGNQIVVLAHGFGTDQSVWKHLVPHLVDEYRVILYDNMGAGTTNPEYYDFERYSTLEGFVYDLLAILEEFQVQSCIFVGHSLSSMVGVIASISHPQLFSKLILLSASPR*
• ORF Type: complete

Annotations of Ll_transcript_405124

• Blastp: Probable esterase KAI2 from Arabidopsis with 70.73% of identity
• Blastx: Probable esterase D14L from Oryza sativa with 78.91% of identity
• Eggnog: Alpha beta hydrolase(COG0596)
• Kegg: Link to kegg annotations (AT4G37470)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431008.1)
• Pfam: Serine aminopeptidase, S33 (PF12146.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;