Protein coding transcript 74306

• Transcript: Ll_transcript_405130
• CDS coordinates: 94-912 (+)
• Peptide sequence: MGIIEEAHNVRVIGKGNQIVVLAHGFGTDQSVWKHLVPHLVDEYRVILYDNMGAGTTNPEYYDFERYSTLEGFVYDLLAILEEFQVQSCIFVGHSLSSMVGVIASISHPQLFSKLILLSASPRFLNDENYYGGFEQEDLSQLFEAIQSNYKAWCSGFAPLVVSGDMDSVAVQEFSRTLFNMRPDIALSMAQTIFQFDMRQILNFVTVPCHIIQSTKDLAVPLVVAEYLQQNVGGKSIVEVMPTEGHLPQLSSPDIVIPVLINHIRNDIAEPK*
• ORF Type: complete

Annotations of Ll_transcript_405130

• Blastp: Probable esterase KAI2 from Arabidopsis with 74.72% of identity
• Blastx: Probable esterase KAI2 from Arabidopsis with 74.72% of identity
• Eggnog: Alpha beta hydrolase(COG0596)
• Kegg: Link to kegg annotations (AT4G37470)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431008.1)
• Pfam: Serine aminopeptidase, S33 (PF12146.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;