Transcript | Ll_transcript_406594 |
---|---|
CDS coordinates | 239-565 (+) |
Peptide sequence | MPSMLLNHFLALVSKETIKTTSAQLNLCICNSVPASIHQPMDQAPAQAMLRQAQTQATHKAQKADEAYQAHKADQAHQAYQAHKADQAHQAYQAHKADQAHQAYQAHKA |
ORF Type | 3prime_partial |
Blastp | - |
---|---|
Blastx | Protein MET1, chloroplastic from Arabidopsis with 72.34% of identity |
Eggnog | NA(ENOG410ZEH3) |
Kegg | Link to kegg annotations (AT1G55480) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019444205.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer