| Transcript | Ll_transcript_405421 |
|---|---|
| CDS coordinates | 61-408 (+) |
| Peptide sequence | MRYGTVPLVASTGGLVDTVKEGFTGFQMGAFNVECEAVDPADVDALAKTVKRALAVHGTPAFREIIKNCMAQDLSWKGPAKKWEEVLLSLGVPGSEPGIDGEEIAPQAKENVATP* |
| ORF Type | complete |
| Blastp | Granule-bound starch synthase 1, chloroplastic/amyloplastic from Antirrhinum with 77.39% of identity |
|---|---|
| Blastx | Granule-bound starch synthase 1, chloroplastic/amyloplastic from Antirrhinum with 78.52% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019454627.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer