Protein coding transcript 74412

• Transcript: Ll_transcript_405424
• CDS coordinates: 44-406 (+)
• Peptide sequence: MHQLSYMNLKQGRFPLADFSLLNLPDQFKSSFDFLDGHIKPVIGRKINWMKAGIIESHLVLTVSPYYAQELVSGPDKGVELDNIIRKNGITGIVNGMDVQEWNPSTDKYITVKYTAATVRI
• ORF Type: 3prime_partial

Annotations of Ll_transcript_405424

• Blastp: Granule-bound starch synthase 1, chloroplastic/amyloplastic from Solanum with 69.75% of identity
• Blastx: Granule-bound starch synthase 1, chloroplastic/amyloplastic from Solanum with 69.17% of identity
• Eggnog: starch synthase activity(COG0297)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422043.1)
• Pfam: Starch synthase catalytic domain (PF08323.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;