Protein coding transcript 74413

• Transcript: Ll_transcript_405430
• CDS coordinates: 3-404 (+)
• Peptide sequence: TIYQPFGIFKKARVVFCIHNIAYQGRFPLADFSLLNLPDQFKSSFDFLDGHIKPVIGRKINWMKAGIIESHLVLTVSPYYAQELVSGPDKGVELDNIIRKNGITGIVNGMDVQEWNPSTDKYITVKYTAATVRI
• ORF Type: internal

Annotations of Ll_transcript_405430

• Blastp: Granule-bound starch synthase 1, chloroplastic/amyloplastic from Manihot with 74.24% of identity
• Blastx: Granule-bound starch synthase 1, chloroplastic/amyloplastic from Manihot with 74.24% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454627.1)
• Pfam: Starch synthase catalytic domain (PF08323.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;