Transcript | Ll_transcript_406630 |
---|---|
CDS coordinates | 747-1055 (+) |
Peptide sequence | MKFMKLGSRPDTFYTAEAVRSVSSEVSSDLIIQVKGSRYLLHKFPLLSKCLRLQRLCSESLDSPQHQIVQLPDFPGGVEAFELCAKFCYGITITLSPYNIVAA |
ORF Type | 3prime_partial |
Blastp | BTB/POZ domain-containing protein At1g67900 from Arabidopsis with 81.55% of identity |
---|---|
Blastx | BTB/POZ domain-containing protein At1g67900 from Arabidopsis with 81.55% of identity |
Eggnog | BTB POZ domain-containing protein(ENOG410YBGR) |
Kegg | Link to kegg annotations (AT1G67900) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019424116.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer