Transcript | Ll_transcript_407588 |
---|---|
CDS coordinates | 89-424 (+) |
Peptide sequence | MGSLGVRKGAWNKFEDELLTACVQQYGEGKWHLVPKRAGLNRCRKSCRLRWLNYLNPNIKRGEFNEDEVDLMLRLHKLLGNRFNFTCSCYYSCLYNYILTTLVFVYNTVNS* |
ORF Type | complete |
Blastp | Transcription factor MYB1 from Beta with 64.77% of identity |
---|---|
Blastx | Transcription factor MYB113 from Arabidopsis with 67.44% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019426715.1) |
Pfam | Myb-like DNA-binding domain (PF00249.30) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer