| Transcript | Ll_transcript_407588 |
|---|---|
| CDS coordinates | 89-424 (+) |
| Peptide sequence | MGSLGVRKGAWNKFEDELLTACVQQYGEGKWHLVPKRAGLNRCRKSCRLRWLNYLNPNIKRGEFNEDEVDLMLRLHKLLGNRFNFTCSCYYSCLYNYILTTLVFVYNTVNS* |
| ORF Type | complete |
| Blastp | Transcription factor MYB1 from Beta with 64.77% of identity |
|---|---|
| Blastx | Transcription factor MYB113 from Arabidopsis with 67.44% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019426715.1) |
| Pfam | Myb-like DNA-binding domain (PF00249.30) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer