Protein coding transcript 74531

• Transcript: Ll_transcript_407787
• CDS coordinates: 117-575 (+)
• Peptide sequence: MWETKKTTTYLLEALSLDSSVVGGTLGWGCLNHREVLADPRIKPRHCHNLLYVGPLWSLVLPLIVVDFTASWCGPCRFIAPILAEIAKKTPEVTFLKVDVDELKTVAEEWGVQAMPTFLFLKKGKIVDTVVGAKKEELQLTIVKHSTAASSS*
• ORF Type: complete

Annotations of Ll_transcript_407787

• Blastp: Thioredoxin H-type from Ricinus with 78.65% of identity
• Blastx: Thioredoxin H-type from Ricinus with 79.31% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (8266412)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436872.1)
• Pfam: Thioredoxin (PF00085.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;