Protein coding transcript 746

• Transcript: Ll_transcript_321990
• CDS coordinates: 2-655 (+)
• Peptide sequence: FLTRELAEEGYSGVEVRVTPNRTEVIILATRTQNVLGEKGKRIRELTSVVQKRFQFPPNSLELYAEKVATRGLCAIAQAESLRYKLIGGLADRRACDGVLRFIMENGARGCEVVVSGKLRGQRAKSMKFVDGLMIHSGDPCNEYVNTATRHVLLRQGVLGIKVKIMLPYDPLGKTGPKKHLPDNVTVIDPKDEGPVAAPISGLDSKMKTGEMPTPAS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_321990

• Blastp: 40S ribosomal protein S3-A from Xenopus with 84.08% of identity
• Blastx: 40S ribosomal protein S3-A from Xenopus with 84.08% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (444841)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004497122.1)
• Pfam: KH domain (PF07650.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;