Protein coding transcript 74640

• Transcript: Ll_transcript_405006
• CDS coordinates: 61-897 (+)
• Peptide sequence: MSTITNAQVSVPAQRLLGKVALVTGGGSGIGESITRLFHIHGAKVCIADLQDNLAKQLSESLGGEANVSFYHCDVTLEDDVRGAVDFAVEKFGTLDIIVNNAGISGSPCTDIRDTILSEFDKVFNINVKGVFHGMKHAARIMIPKKKGSIISLASVASTTGGIGIHAYTGSKHAVVGLTKSVAAELGKHGIRANCVSPYAVLTGLALAHLPENERNDDAIAGFRNFVGSNANLQGVELTTDDVANAVLFLASDESRYISGDNLMVDRGFTNVNHSLGVF
• ORF Type: 3prime_partial

Annotations of Ll_transcript_405006

• Blastp: Xanthoxin dehydrogenase from Arabidopsis with 69.52% of identity
• Blastx: Xanthoxin dehydrogenase from Arabidopsis with 69.52% of identity
• Eggnog: Dehydrogenase reductase(COG1028)
• Kegg: Link to kegg annotations (AT1G52340)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427658.1)
• Pfam: short chain dehydrogenase (PF00106.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;