Protein coding transcript 74645

• Transcript: Ll_transcript_405022
• CDS coordinates: 11-883 (+)
• Peptide sequence: MKPENLLQNIHLRTQKCSVGCPTLNHFLNGGVPCNSITELVAESGSGKTQFCLQLALSAQLPPSHGGLSASSLYIHSEFPFPIRRLRQLSLALRSTYPHLFRSVDPCDSVFVRGVYSADEFVQLIPIIELHILNSKFRLPVRVIVVDSIAALFRSDFENTGSDLRRRSSLFFKISGALKSLAKRYGLAVMVTNQVVDMIGGACPGITGMRIGNLTELYSSGRQICPALGLAWANCVNSRLFLSRDQAVNGNGELYQRRRLCVVFAPHLPASSCDIVIKGEGVFGVEMQQA*
• ORF Type: complete

Annotations of Ll_transcript_405022

• Blastp: DNA repair protein XRCC3 homolog from Arabidopsis with 51.67% of identity
• Blastx: DNA repair protein XRCC3 homolog from Arabidopsis with 51.49% of identity
• Eggnog: Can catalyze the hydrolysis of ATP in the presence of single-stranded DNA, the ATP-dependent uptake of single-stranded DNA by duplex DNA, and the ATP-dependent hybridization of homologous single-stranded DNAs. It interacts with LexA causing its activation and leading to its autocatalytic cleavage (By similarity)(COG0468)
• Kegg: Link to kegg annotations (AT5G57450)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415847.1)
• Pfam: Rad51 (PF08423.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;