Protein coding transcript 747

• Transcript: Ll_transcript_321983
• CDS coordinates: 3-308 (+)
• Peptide sequence: SIKAIEKNLGLRKEDMEPATMTLYRFGNTSTSSIWYELCYIEAKGRMKCGDRVWQLAFGSGFKCNSAVWKCLCDVKPDTASAWSDTIHSYPIEVPDIVRMN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_321983

• Blastp: Probable 3-ketoacyl-CoA synthase 21 from Arabidopsis with 66.32% of identity
• Blastx: Probable 3-ketoacyl-CoA synthase 21 from Arabidopsis with 66.32% of identity
• Eggnog: 3-ketoacyl-coa synthase(ENOG4111AD9)
• Kegg: Link to kegg annotations (AT5G49070)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439291.1)
• Pfam: 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal (PF08541.9)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;