Transcript | Ll_transcript_407744 |
---|---|
CDS coordinates | 219-569 (+) |
Peptide sequence | MSMAVEEEKENEVVKGGELLFCGATCWDMVGRKKGIDGNLVSPSRLRPLIGIDIRYVAAGCASCHCVALDVEGRCYTWGGNDKGQLGHGDTTQRDRPTVVSGLSKFSKLDQGGVIQ* |
ORF Type | complete |
Blastp | Protein RCC2 homolog from Xenopus with 37.93% of identity |
---|---|
Blastx | Protein RCC2 from Homo with 40% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (734455) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019417033.1) |
Pfam | Regulator of chromosome condensation (RCC1) repeat (PF00415.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer