| Transcript | Ll_transcript_407744 |
|---|---|
| CDS coordinates | 219-569 (+) |
| Peptide sequence | MSMAVEEEKENEVVKGGELLFCGATCWDMVGRKKGIDGNLVSPSRLRPLIGIDIRYVAAGCASCHCVALDVEGRCYTWGGNDKGQLGHGDTTQRDRPTVVSGLSKFSKLDQGGVIQ* |
| ORF Type | complete |
| Blastp | Protein RCC2 homolog from Xenopus with 37.93% of identity |
|---|---|
| Blastx | Protein RCC2 from Homo with 40% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (734455) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019417033.1) |
| Pfam | Regulator of chromosome condensation (RCC1) repeat (PF00415.17) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer