Protein coding transcript 74739

• Transcript: Ll_transcript_407747
• CDS coordinates: 1982-2647 (+)
• Peptide sequence: MWGKLKNNGDDWMYPKPLMDLSGWNLRCMDSGGMHHFVGADSSCISWGQAQNGELGYGPMGQKSSAVPKKVDILEGMHIMSVACGMAHSMVIVDRTNVADRLEQLDVYDGKAIGEANEPAAKAVVPKQTAKKGAKGVDNSKKRKNAKDSSDEEEDEDTEESDNSDEDEVNGEIEVKRAGRGRGRASASKNSSSGRGRGRGRTPAAPPVKSSGKRGRPRKSS*
• ORF Type: complete

Annotations of Ll_transcript_407747

• Blastp: Protein RCC2 from Homo with 39.15% of identity
• Blastx: Protein RCC2 from Homo with 39.15% of identity
• Eggnog: regulator of chromosome condensation(COG5184)
• Kegg: Link to kegg annotations (55920)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415445.1)
• Pfam: Regulator of chromosome condensation (RCC1) repeat (PF00415.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;