Transcript | Ll_transcript_407747 |
---|---|
CDS coordinates | 1982-2647 (+) |
Peptide sequence | MWGKLKNNGDDWMYPKPLMDLSGWNLRCMDSGGMHHFVGADSSCISWGQAQNGELGYGPMGQKSSAVPKKVDILEGMHIMSVACGMAHSMVIVDRTNVADRLEQLDVYDGKAIGEANEPAAKAVVPKQTAKKGAKGVDNSKKRKNAKDSSDEEEDEDTEESDNSDEDEVNGEIEVKRAGRGRGRASASKNSSSGRGRGRGRTPAAPPVKSSGKRGRPRKSS* |
ORF Type | complete |
Blastp | Protein RCC2 from Homo with 39.15% of identity |
---|---|
Blastx | Protein RCC2 from Homo with 39.15% of identity |
Eggnog | regulator of chromosome condensation(COG5184) |
Kegg | Link to kegg annotations (55920) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019415445.1) |
Pfam | Regulator of chromosome condensation (RCC1) repeat (PF00415.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer