Protein coding transcript 74748

• Transcript: Ll_transcript_405892
• CDS coordinates: 80-970 (+)
• Peptide sequence: MSGSSCEQELGLMSINENSNKSSWVPPENQNVTGSDQVNNLPGKDKSWVGASSKSESSSESPVPDHPAGPSNQCLPKFYSPGTKCPSICEDNMYPDFEMGEADMNLENYDELFGMTLTHSEELFENGGFDSLFGTKDISAEDSDCLGAVAAESSVELVNAIQPACSNAESADSILSTKTEPIICYTARQAPSNISFSVTAGESNAGDYQDCGASSMRLMGEPPWHAPFPENSLHSASNRSNAVMRYKEKKKIRKFDKRVRYASRKERADVRRRVKGRFVKVGDAYDYDPLGPTRSY*
• ORF Type: complete

Annotations of Ll_transcript_405892

• Blastp: Zinc finger protein CONSTANS-LIKE 9 from Arabidopsis with 50.46% of identity
• Blastx: Zinc finger protein CONSTANS-LIKE 9 from Arabidopsis with 48.92% of identity
• Eggnog: Zinc finger protein CONSTANS-LIKE(ENOG410YA5C)
• Kegg: Link to kegg annotations (AT3G07650)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431942.1)
• Pfam: CCT motif (PF06203.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;