Protein coding transcript 74754

• Transcript: Ll_transcript_407309
• CDS coordinates: 749-1312 (+)
• Peptide sequence: MYYVIQTLIQTLHKRPFRYFNMSESYQIINVFDSASFRTAVVNFNLDFTDRVLSTDMCERNTCLALNFIIFYSSNNLANLIDNCSENVGLLGLTHIGSRRVVQISCAFMIFFAIFGKFGAFFASIPVSIFAAIYCVLYGIVAAVGISMIQFANNNSMRNMYVFGLALFLGISIPQYFVMNSAPDGHGP
• ORF Type: 3prime_partial

Annotations of Ll_transcript_407309

• Blastp: Nucleobase-ascorbate transporter 3 from Arabidopsis with 71.84% of identity
• Blastx: Nucleobase-ascorbate transporter 3 from Arabidopsis with 71.84% of identity
• Eggnog: permease(COG2233)
• Kegg: Link to kegg annotations (AT2G26510)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443153.1)
• Pfam: Permease family (PF00860.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;