Protein coding transcript 74758

• Transcript: Ll_transcript_407996
• CDS coordinates: 2-352 (+)
• Peptide sequence: TPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVVKPGMVVTFGPTGLTT
• ORF Type: internal

Annotations of Ll_transcript_407996

• Blastp: Elongation factor 1-alpha from Lycopersicon with 98.29% of identity
• Blastx: Elongation factor 1-alpha from Lycopersicon with 98.29% of identity
• Eggnog: This protein promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis (By similarity)(COG5256)
• Kegg: Link to kegg annotations (101244084)
• CantataDB: Link to cantataDB annotations (CNT0000351)
• Mirbase: egu-MIR172d (MI0020570)
• Ncbi protein: Link to NCBI protein (XP_019427228.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;