Transcript | Ll_transcript_407200 |
---|---|
CDS coordinates | 2-463 (+) |
Peptide sequence | RVGADAWSLMYPSIPDKLQSLYNDGFKVVIFTNESNIERWKNKRQAAVDSKIGRLNNFIERVKVPIQVFIACGVGNSGKGKAAIKEDDPFRKPKPGMWQLMEKHFNSSISIDMDQSFYVGDAAGREKDHSNADIKFAEAIGLKFYVPEKYFDA* |
ORF Type | 5prime_partial |
Blastp | Polynucleotide 3'-phosphatase ZDP from Arabidopsis with 75.33% of identity |
---|---|
Blastx | Polynucleotide 3'-phosphatase ZDP from Arabidopsis with 75.33% of identity |
Eggnog | histidinol-phosphatase activity(COG0241) |
Kegg | Link to kegg annotations (AT3G14890) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019449579.1) |
Pfam | Polynucleotide kinase 3 phosphatase (PF08645.10) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer