Protein coding transcript 74983

• Transcript: Ll_transcript_406254
• CDS coordinates: 770-1348 (+)
• Peptide sequence: MAVSMRDLDPAFQGAGQKAGLEIWRIENFNPVPIPKSSYGKFFTGDSYVILKTTALKSGALRHDIHYWLGKDTSQDEAGAAAIKTVELDAALGGRAVQYREVQGHETENFLSYFKPCIIPQEGGVASGFKHAVPEKHNTRLFVCRGKHVVHVKEVPFARSSLSHDDIYVASGFKHAVPERHNTRLFVCRGNS*
• ORF Type: complete

Annotations of Ll_transcript_406254

• Blastp: Villin-4 from Arabidopsis with 89.94% of identity
• Blastx: Villin-4 from Arabidopsis with 89.94% of identity
• Eggnog: capping protein (actin filament) gelsolin-like(ENOG410XR0A)
• Kegg: Link to kegg annotations (AT4G30160)
• CantataDB: Link to cantataDB annotations (CNT0002809)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439366.1)
• Pfam: Gelsolin repeat (PF00626.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;