Protein coding transcript 750

• Transcript: Ll_transcript_323385
• CDS coordinates: 2-475 (+)
• Peptide sequence: NHNFPIMSALFVNRNVLLLMSLIALVTSQVIVDVVSWELIVKTKVSMTNKMSEPISIHCRDMNNDDGLNTFEPGKSYNFKVVLNPFSAKTLWYCRFGWKGVYHFFDIYDQRRDLNCNNSECIWNIYQDGPCRVDPGQNGTTCFQWKKMNNTTKGKYY*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_323385

• Blastp: S-protein homolog 3 from Arabidopsis with 32.86% of identity
• Blastx: S-protein homolog 2 from Arabidopsis with 32.74% of identity
• Eggnog: Plant self-incompatibility protein S1(ENOG411149S)
• Kegg: Link to kegg annotations (AT5G12060)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442396.1)
• Pfam: Plant self-incompatibility protein S1 (PF05938.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;