Transcript | Ll_transcript_415174 |
---|---|
CDS coordinates | 1759-2622 (+) |
Peptide sequence | MNWRRAMLTDSGGFQMVSLLHLADITEKGVTFQSPVDGKPMLLTPEESIQIQNRIGADIIMALDDVVKTTITGPRIEEAMYRTLRWIDRCIEAHGRPHDQNLFGIVQGGLDPVLRDICIKGLVDRNLPGYAIGGLAGGEDKDSFWRVVAQCTGSLPEDKPRYVMGVGYPLDVVVCSALGADMYDCVYPTRTARFGTALVPEGVLKLKQRAMADDTRPIDPTCPCMVCKNYSRAYIHCLVTKDAMGSQLLSYHNLYYMMQVQRLSHNRRFFCKFMINIFTCMIESVSF* |
ORF Type | complete |
Blastp | Queuine tRNA-ribosyltransferase catalytic subunit 1 from Xenopus with 59.16% of identity |
---|---|
Blastx | Queuine tRNA-ribosyltransferase catalytic subunit 1 from Xenopus with 52.94% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (734584) |
CantataDB | Link to cantataDB annotations (CNT0000446) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019416066.1) |
Pfam | Queuine tRNA-ribosyltransferase (PF01702.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer