Protein coding transcript 75175

• Transcript: Ll_transcript_415178
• CDS coordinates: 1405-2418 (+)
• Peptide sequence: MPVGTQGTIKGLTNSQLEDIGCQIILGNTYHLALRPTSELLAEAGGLHKFMNWRRAMLTDSGGFQMVSLLHLADITEKGVTFQSPVDGKPMLLTPEESIQIQNRIGADIIMALDDVVKTTITGPRIEEAMYRTLRWIDRCIEAHGRPHDQNLFGIVQGGLDPVLRDICIKGLVDRNLPGYAIGGLAGGEDKDSFWRVVAQCTGSLPEDKPRYVMGVGYPLDVVVCSALGADMYDCVYPTRTARFGTALVPEGVLKLKQRAMADDTRPIDPTCPCMVCKNYSRAYIHCLVTKDAMGSQLLSYHNLYYMMQVQRLSHNRRFFCKFMINIFTCMIESVSF*
• ORF Type: complete

Annotations of Ll_transcript_415178

• Blastp: Queuine tRNA-ribosyltransferase catalytic subunit 1 from Silurana with 60.26% of identity
• Blastx: Queuine tRNA-ribosyltransferase catalytic subunit 1 from Xenopus with 53.46% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (394694)
• CantataDB: Link to cantataDB annotations (CNT0000446)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416066.1)
• Pfam: Queuine tRNA-ribosyltransferase (PF01702.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;