Protein coding transcript 75190

• Transcript: Ll_transcript_415194
• CDS coordinates: 1302-2552 (+)
• Peptide sequence: MPVGTQGTIKGLTNSQLEDIGCQIILGNTYHLALRPTSELLAEAGGLHKFMNWRRAMLTDSGGFQMVSLLHLADITEKGVTFQSPVDGKPMLLTPEESIQIQNRIGADIIMALDDVVKTTITGPRIEEAMYRTLRWIDRCIEAHGRPHDQNLFGIVQGGLDPVLRDICIKGLVDRNLPGYAIGGLAGGEDKDSFWRVVAQCTGSLPEDKPRYVMGVGYPLDVVVCSALGADMYDCVYPTRTARFGTALVPEGVLKLKQRAMADDTRPIDPTCPCMVCKNYSRAYIHCLVTKDAMGSQLLSYHNLYYMMQLSRDLHSSIVEGRFPKFVCDFLSKMFPEGNVPEWVCNAMEVAGIDISSCCTFSERVCNAKVAGIDISSDCTLSSSCGEHDSDNVSDKYDELKLKLERLRNNEDALRR*
• ORF Type: complete

Annotations of Ll_transcript_415194

• Blastp: Queuine tRNA-ribosyltransferase catalytic subunit 1 from Silurana with 57.7% of identity
• Blastx: Queuine tRNA-ribosyltransferase catalytic subunit 1 from Xenopus with 56.76% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (394694)
• CantataDB: Link to cantataDB annotations (CNT0000446)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416066.1)
• Pfam: Queuine tRNA-ribosyltransferase (PF01702.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;