Protein coding transcript 75236

• Transcript: Ll_transcript_416723
• CDS coordinates: 1-720 (+)
• Peptide sequence: QNFPRRLRHQIFQWLASMPLELEGYIRPGCTILTTFVAMPKTTWINLLEDPLHYVCDLVAPGKMLSGKGSALVHLDDMIFRVMKDGTSVMKVEVNMQAPRLHYVHPTYFEAGKPMEFVACGSNLLQSKFRLLVSFSGKYQKFDSCVRSAHNWTGDNVSCAFNNQLYKIHVPHTEESLFGPAFIEVENESGLSNFIPVLIGDKEICIEMKRLEQKLDVSLLSEQFQSASVGSVCSSCQAFA
• ORF Type: internal

Annotations of Ll_transcript_416723

• Blastp: Squamosa promoter-binding-like protein 7 from Arabidopsis with 55.23% of identity
• Blastx: Squamosa promoter-binding-like protein 7 from Arabidopsis with 55.23% of identity
• Eggnog: Squamosa promoter-binding-like protein(ENOG4111YFE)
• Kegg: Link to kegg annotations (AT5G18830)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419596.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;