Transcript | Ll_transcript_416708 |
---|---|
CDS coordinates | 86-1027 (+) |
Peptide sequence | MEPSSQSESQSHPPQSMDSPLWDLTELLNFNLDDIQISPSVDHHDPLLPPSPDILKIRKRDPRLTCSNFLAGHVPCACPELDAKLDDEGLPGKKRVRTARASVGIVRCQVPTCEVDISELKGYHKRHRVCLSCASAATVLLHGDEPNRYCQQCGKFHILSDFDEGKRSCRRKLERHNKRRRRKPTDSEVAAGHELEHATQNEDFSYDGEAGKDCSNSSGEINEKEVSPDHEDEPLAILRSAPDTKNVNSDDVPSHVASSETQVNSGKDVSNIFNTPSYCDNKSAYSSMVGCPTCLLILFQIFIFVQEIMIDFC* |
ORF Type | complete |
Blastp | Squamosa promoter-binding-like protein 7 from Arabidopsis with 47.68% of identity |
---|---|
Blastx | Squamosa promoter-binding-like protein 7 from Arabidopsis with 49.46% of identity |
Eggnog | Squamosa promoter-binding-like protein(ENOG4111YFE) |
Kegg | Link to kegg annotations (AT5G18830) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019419596.1) |
Pfam | SBP domain (PF03110.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer