| Transcript | Ll_transcript_323392 |
|---|---|
| CDS coordinates | 2-343 (+) |
| Peptide sequence | SSQPSKKSLRNSGGGPGSSGSSQGGARDSSGGPSVKFARRTSSGRYVSLSREDIDMSSELSGDYMNYTVHIPPTPEHEPSDTSIAMKAEEQYVSNSLFTGGFNSVTRAHLMDKV |
| ORF Type | internal |
| Blastp | Cellulose synthase-like protein D3 from Oryza sativa with 68.07% of identity |
|---|---|
| Blastx | Cellulose synthase-like protein D3 from Oryza sativa with 68.07% of identity |
| Eggnog | Glycosyl transferase, family 2(COG1215) |
| Kegg | Link to kegg annotations (9271833) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019454873.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer