Protein coding transcript 75440

• Transcript: Ll_transcript_414328
• CDS coordinates: 124-990 (+)
• Peptide sequence: MAGRYDANPFAEEEVNPFSNPGSVAPATNSRLAPLNPEPAGYNYGYGATINIPLDPSTDLKKKEKELQAKESELRRREQDVKRKEEAAARAGISLDEKNWPPIFPIIHHDIANEIPIHLQRLQYVAFTSFLGLVSCLTWNIIAVTAAWIKGEGVTIWFLSIIYFISGVPGAYVLWYRPLYRAFRTDSALNYGWFFMFYLLHIGFCILAAVAPPIVFKGKSLTGILAAIDVLNGHAVVGILYFIGFGYFCIETLISIWVIQQVYMYFRGSGKAVEMRQEAARGAMRAAF*
• ORF Type: complete

Annotations of Ll_transcript_414328

• Blastp: Secretory carrier-associated membrane protein 3 from Arabidopsis with 75.17% of identity
• Blastx: Secretory carrier-associated membrane protein from Pisum with 79.41% of identity
• Eggnog: secretory carrier membrane protein(ENOG410XSJN)
• Kegg: Link to kegg annotations (AT1G61250)
• CantataDB: Link to cantataDB annotations (CNT0002274)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440278.1)
• Pfam: SCAMP family (PF04144.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;