Protein coding transcript 75441

• Transcript: Ll_transcript_414329
• CDS coordinates: 1-1014 (+)
• Peptide sequence: ADQRGKYYFFLYIASITIFFFSTPFPCITSFIFLIWPFQKSFFSFNSPYIFRSLYYLVPVPRLQPQPLLMAGRYDANPFAEEEVNPFSNPGSVAPATNSRLAPLNPEPAGYNYGYGATINIPLDPSTDLKKKEKELQAKESELRRREQDVKRKEEAAARAGISLDEKNWPPIFPIIHHDIANEIPIHLQRLQYVAFTSFLGLVSCLTWNIIAVTAAWIKGEGVTIWFLSIIYFISGVPGAYVLWYRPLYRAFRTDSALNYGWFFMFYLLHIGFCILAAVAPPIVFKGKSLTGILAAIDVLNGHAVVGVSMPILKYFVFLHARTPPFRLSNLRHAEPT*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_414329

• Blastp: Secretory carrier-associated membrane protein from Pisum with 78.9% of identity
• Blastx: Secretory carrier-associated membrane protein from Pisum with 78.9% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0002274)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440278.1)
• Pfam: SCAMP family (PF04144.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;