Protein coding transcript 75449

• Transcript: Ll_transcript_414337
• CDS coordinates: 125-703 (+)
• Peptide sequence: MHFYLLLLECLLTYYFAAGISLDEKNWPPIFPIIHHDIANEIPIHLQRLQYVAFTSFLGLVSCLTWNIIAVTAAWIKGEGVTIWFLSIIYFISGVPGAYVLWYRPLYRAFRTDSALNYGWFFMFYLLHIGFCILAAVAPPIVFKGKSLTGILSAIDVVGDHALIGIFYFIGFGLFCLETLISLWVIQQVYMYF
• ORF Type: 3prime_partial

Annotations of Ll_transcript_414337

• Blastp: Secretory carrier-associated membrane protein 3 from Arabidopsis with 76.7% of identity
• Blastx: Secretory carrier-associated membrane protein from Pisum with 85.23% of identity
• Eggnog: secretory carrier membrane protein(ENOG410XSJN)
• Kegg: Link to kegg annotations (AT1G61250)
• CantataDB: Link to cantataDB annotations (CNT0002274)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440279.1)
• Pfam: SCAMP family (PF04144.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;