Transcript | Ll_transcript_414295 |
---|---|
CDS coordinates | 238-855 (+) |
Peptide sequence | MAGRYDNPFEEEEVNPFSNLGSVAPAKNSRLSPLRPERADYNYGFGETVDIPLDTSSDLKKKEKELQSKEAELKKREQDVRRKEEAAARAGIVIEEKNWPPFFPIIHHDIANEIPAPLQRLQYVAFTTLLGLTLCLFWNIIAVTAAWIKGEGVKIWFLAIIYFIAGVPGGYFLWYRPLYRAFRNESALKFGWFFMFYMVNSLYFS* |
ORF Type | complete |
Blastp | Secretory carrier-associated membrane protein from Pisum with 79.6% of identity |
---|---|
Blastx | Secretory carrier-associated membrane protein from Pisum with 79.6% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019445631.1) |
Pfam | SCAMP family (PF04144.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer