Protein coding transcript 755

• Transcript: Ll_transcript_401387
• CDS coordinates: 1-312 (+)
• Peptide sequence: WICCDVYDTGIGIPEKGIHTLFKRYMQVSADHARKYGGTGLGLAICKQLVELMGGRLTVSSKEHCGSTFTFILPYKVSTACDDDSDDFDVEKNDGMSDDTTQGF
• ORF Type: internal

Annotations of Ll_transcript_401387

• Blastp: Histidine kinase 5 from Arabidopsis with 68.22% of identity
• Blastx: Histidine kinase 5 from Arabidopsis with 81.82% of identity
• Eggnog: Histidine kinase(ENOG410XNMH)
• Kegg: Link to kegg annotations (AT5G10720)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458873.1)
• Pfam: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase (PF02518.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;