Protein coding transcript 75503

• Transcript: Ll_transcript_415441
• CDS coordinates: 292-678 (+)
• Peptide sequence: MYSESFFKGFRKWYHKTLSLLVQIIFMATNCGASKRKASDEIDYVNFSIRGQDGSLLFYKVNNDTEFKHVFEDYCKKKRLEYATIQFLHEGQRVLGRQKPKKRNLEDGAEILAMKQVMGGGVATLIFY*
• ORF Type: complete

Annotations of Ll_transcript_415441

• Blastp: Small ubiquitin-related modifier 2 from Arabidopsis with 33.72% of identity
• Blastx: Small ubiquitin-related modifier 2 from Arabidopsis with 33.72% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT5G55160)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460654.1)
• Pfam: Ubiquitin-2 like Rad60 SUMO-like (PF11976.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;