Protein coding transcript 75561

• Transcript: Ll_transcript_416203
• CDS coordinates: 716-1255 (+)
• Peptide sequence: MLLFTNEDDPFGSMNGAIKSDMTRTTLQRAKDAQDLGISIELLPLSCPDEVFNVSQFYADLIGLEGDHLVDFMPSAGNKLEDMKDQLRKRMFTKRIVKRIKFMIANGISIDLNSYALIRPTVPGAITWLDSVTNRPLKSERTFICADTGALVEESSRRFHPYKKYAVDLMLISLSYLPF*
• ORF Type: complete

Annotations of Ll_transcript_416203

• Blastp: ATP-dependent DNA helicase 2 subunit KU70 from Arabidopsis with 63.84% of identity
• Blastx: ATP-dependent DNA helicase 2 subunit KU70 from Arabidopsis with 64.32% of identity
• Eggnog: X-ray repair complementing defective repair in Chinese hamster cells 6(ENOG410XNXU)
• Kegg: Link to kegg annotations (AT1G16970)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441577.1)
• Pfam: Ku70/Ku80 N-terminal alpha/beta domain (PF03731.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;