Protein coding transcript 75568

• Transcript: Ll_transcript_416192
• CDS coordinates: 4095-4661 (+)
• Peptide sequence: MIYLPYSDDIRLIEERFSDSSGMVPKASDDQIKKAADLIKRIDLKDFSVCQFANPALQRHYAVLQALALEEDEIPEMKDETLPDEEGLARPGVVRAIEEFKTSIYGENYDEESEQPAGKPSETSRKRKAIAEFATKECGNYEWGDLADTGKLKDLTVVELKYYLAAHDLPVSGKKEALISRILTHMGK*
• ORF Type: complete

Annotations of Ll_transcript_416192

• Blastp: ATP-dependent DNA helicase 2 subunit KU70 from Oryza sativa with 65.43% of identity
• Blastx: ATP-dependent DNA helicase 2 subunit KU70 from Arabidopsis with 69.28% of identity
• Eggnog: X-ray repair complementing defective repair in Chinese hamster cells 6(ENOG410XNXU)
• Kegg: Link to kegg annotations (4342584)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441578.1)
• Pfam: Ku70/Ku80 C-terminal arm (PF03730.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;