Protein coding transcript 75589

• Transcript: Ll_transcript_415590
• CDS coordinates: 1-816 (+)
• Peptide sequence: QKSSLLSLLPIFYSLFSISHLNFLSHSFTLSLFLFLSPNSSFRFTMPFLSEAASAIKNRFRFNDHSSDSVSLFQNTPDLLKSAAKDNLTTHSSIRTIQNWDENDEDAAVESSNNAVGSSSQRFEVIEDPSFWKDHNVQVIIRMRPLSNAEISVQGYGKCIRQESSQAITWTGHPESRFTFDLVADENVTQEKLFKVAGLPMVENCMGGYNSCMFAYGQTGSGKTHTMLGDIEGGTRRHSVNCGMTPRIFEHLFSRIQKVQFVMSLDADDYE*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_415590

• Blastp: Kinesin-like protein KIN-12E from Arabidopsis with 67.28% of identity
• Blastx: Kinesin-like protein KIN-12E from Oryza sativa with 74.62% of identity
• Eggnog: Kinesin family member(COG5059)
• Kegg: Link to kegg annotations (AT3G44050)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447716.1)
• Pfam: Microtubule binding (PF16796.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;