Transcript | Ll_transcript_414019 |
---|---|
CDS coordinates | 177-872 (+) |
Peptide sequence | MATTLLRKEHGLNLKETELCLGLPGGGSEVETPRVNGKRGFSETVDLKLNLPSKEELSENLKNGSKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNVMTQKVSNEDCTEKIGCGAFVKVSMDGAPYLRKVDLTMYKCYQELADALAKMFSSFTTGEYGRQGMIEFMNESKLMDVVNSSEYVPTYEDKDGDWMLVGDVPWEMFVGSCKRLRIMKGSEAIGLAPRAMEKCKRRS* |
ORF Type | complete |
Blastp | Auxin-responsive protein IAA14 from Arabidopsis with 73.8% of identity |
---|---|
Blastx | Auxin-responsive protein IAA14 from Arabidopsis with 73.8% of identity |
Eggnog | Aux IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations. Repression is thought to result from the interaction with auxin response factors (ARFs), proteins that bind to the auxin-responsive promoter element (AuxRE). Formation of heterodimers with ARF proteins may alter their ability to modulate early auxin response genes expression(ENOG410YEC3) |
Kegg | Link to kegg annotations (AT4G14550) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019451124.1) |
Pfam | AUX/IAA family (PF02309.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer