Protein coding transcript 75732

• Transcript: Ll_transcript_413987
• CDS coordinates: 1141-1734 (+)
• Peptide sequence: MHAEGLNNAINSTTVVAVLIATVAFAAIFTVPGQFVDDPDNIPPGMSLGEANIAPQVPFIIFFVFDSIALFISLAVVVVQTSVVVIESKAKKQMMAIINKLMWLACVLVSVAFLALSFVVVGKQEKWLAIGVTIIGTTIMATTLGTMCYWVIRHRIEASNLRNIRKSSMESRSKSFSVSALSDSELLNNEFKKMYAI*
• ORF Type: complete

Annotations of Ll_transcript_413987

• Blastp: Ankyrin repeat-containing protein At5g02620 from Arabidopsis with 66.16% of identity
• Blastx: Ankyrin repeat-containing protein At5g02620 from Arabidopsis with 58.77% of identity
• Eggnog: Ankyrin Repeat(COG0666)
• Kegg: Link to kegg annotations (AT5G02620)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436236.1)
• Pfam: Domain of unknown function (PF13962.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;