Protein coding transcript 75742

• Transcript: Ll_transcript_415222
• CDS coordinates: 953-2119 (+)
• Peptide sequence: MLKEKKMLAFAPIGDTGETGLHVLARKASVCCCQSLQYGKHLLHFCTNDTFILKLINFMWNIFLTELDDSTLMNAIRQPSQVTFIAAEVGNFEFLSVVISTYPDLIWELDTMGRSIIHTAVLHRHASIFNLIHEIGPMKDLILTFVDDERNNLLHCAARLAPPNRLNIVSGAALQMMLELSWFEEVKKIMIPLFIEMKNSEDFTPRQIFTKEHEELLKNGESWMKTTANSCMVVSTLIATGVFSAAFSVPGGNNDNTRSPNYMEKPAFLVFVLSDAIAFISSSTSIIIFLSILMSRCAEEDFLKSLPLMLISGLVALFISIISMMVAFSSAFFITYYHGLKWVPNFISALAFVPIPLFIFLQFPLWSDIVYSTYICSSLFRPSKRMIH*
• ORF Type: complete

Annotations of Ll_transcript_415222

• Blastp: Ankyrin repeat-containing protein ITN1 from Arabidopsis with 21.84% of identity
• Blastx: Alpha-latrotoxin-Lhe1a from Latrodectus with 24.44% of identity
• Eggnog: Ankyrin Repeat(COG0666)
• Kegg: Link to kegg annotations (AT3G12360)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418119.1)
• Pfam: Domain of unknown function (PF13962.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;