Protein coding transcript 75746

• Transcript: Ll_transcript_415202
• CDS coordinates: 168-902 (+)
• Peptide sequence: MAIPDPTSFPNLFQRVASAQFRRPLLHLVSTQENRHRYLTQCVPLHKAALKGDWKEASKIIEQDNTLLKAAITKGWATVLHIAAGTNHVHFVEELVRKLKHEDLELEDEKSNTAFCFAAAVGNVEIAKIMLRRNESLAQIRGGEGLTPLHMALLQGRREMAWYLLPKSKEILQELDWKVLFHICINSELYDLALEMLKEKKMLAFAPIGDTGETGLHVLARKASVCCCQSLQYGKHLLHFCKCL*
• ORF Type: complete

Annotations of Ll_transcript_415202

• Blastp: Delta-latroinsectotoxin-Lt1a from Latrodectus with 28.97% of identity
• Blastx: Alpha-latrotoxin-Lhe1a from Latrodectus with 24.26% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418119.1)
• Pfam: Ankyrin repeats (3 copies) (PF12796.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;