Transcript | Ll_transcript_415203 |
---|---|
CDS coordinates | 168-755 (+) |
Peptide sequence | MAIPDPTSFPNLFQRVASAQFRRPLLHLVSTQENRHRYLTQCVPLHKAALKGDWKEASKIIEQDNTLLKAAITKGWATVLHIAAGTNHVHFVEELVRKLKHEDLELEDEKSNTAFCFAAAVGNVEIAKIMLRRNESLAQIRGGEGLTPLHMALLQGRREMAWYLLPKSKEILQELDWKVLFHICINSELYGKHIA* |
ORF Type | complete |
Blastp | Delta-latroinsectotoxin-Lt1a from Latrodectus with 28.97% of identity |
---|---|
Blastx | Alpha-latrotoxin-Lhe1a from Latrodectus with 24.44% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019418119.1) |
Pfam | Ankyrin repeats (3 copies) (PF12796.6) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer