Transcript | Ll_transcript_415209 |
---|---|
CDS coordinates | 1479-2516 (+) |
Peptide sequence | MSGTNDTFILKLINFMWNIFLTELDDSTLMNAIRQPSQVTFIAAEVGNFEFLSVVISTYPDLIWELDTMGRSIIHTAVLHRHASIFNLIHEIGPMKDLILTFVDDERNNLLHCAARLAPPNRLNIVSGAALQMMLELSWFEEVKKIMIPLFIEMKNSEDFTPRQIFTKEHEELLKNGESWMKTTANSCMVVSTLIATGVFSAAFSVPGGNNDNTRSPNYMEKPAFLVFVLSDAIAFISSSTSIIIFLSILMSRCAEEDFLKSLPLMLISGLVALFISIISMMVAFSSAFFITYYHGLKWVPNFISALAFVPIPLFIFLQFPLWSDIVYSTYICSSLFRPSKRMIH* |
ORF Type | complete |
Blastp | Ankyrin repeat-containing protein ITN1 from Arabidopsis with 21.77% of identity |
---|---|
Blastx | Alpha-latrotoxin-Lhe1a from Latrodectus with 24.26% of identity |
Eggnog | Ankyrin Repeat(COG0666) |
Kegg | Link to kegg annotations (AT3G12360) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019418119.1) |
Pfam | Domain of unknown function (PF13962.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer