Transcript | Ll_transcript_524026 |
---|---|
CDS coordinates | 2-397 (+) |
Peptide sequence | YVWKRRQDGVNVINVGKTWEKLVFAARVIAAIENPNDVCVISARPYGHRAVLKFAANTGAQAIAGRFTPGNFTNYITKSFKEPRLIVVTDPRVDHQAIREASYVNIPVIAICDTDSPLNYVDIAIPANNKSK |
ORF Type | internal |
Blastp | - |
---|---|
Blastx | 40S ribosomal protein S0 from Postia with 87.12% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (POSPLDRAFT_114210) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019423529.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer